| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
| Family c.57.1.2: MoeA central domain-like [64103] (2 proteins) automatically mapped to Pfam PF00994 |
| Protein MoeA, central domain [64104] (4 species) |
| Species Pyrococcus furiosus [TaxId:2261] [117665] (1 PDB entry) Uniprot Q8U034 |
| Domain d1xi8b3: 1xi8 B:182-324 [115354] Other proteins in same PDB: d1xi8a1, d1xi8a2, d1xi8b1, d1xi8b2 Structural genomics target |
PDB Entry: 1xi8 (more details), 2.5 Å
SCOPe Domain Sequences for d1xi8b3:
Sequence, based on SEQRES records: (download)
>d1xi8b3 c.57.1.2 (B:182-324) MoeA, central domain {Pyrococcus furiosus [TaxId: 2261]}
kpkvgiiitgselvqepsleefekgkivdtnsimlsalveryfgepilygvvpdnedlir
salekakrecdlvlitggsafgdmdyahkfvnllfhgttirpgrpigygervfvmsgypv
avftqfhlfvkhalaklvgakdy
>d1xi8b3 c.57.1.2 (B:182-324) MoeA, central domain {Pyrococcus furiosus [TaxId: 2261]}
kpkvgiiitgdtnsimlsalveryfgepilygvvpdnedlirsalekakrecdlvlitgv
nllfhgttirpgrpigygervfvmsgypvavftqfhlfvkhalaklvgakdy
Timeline for d1xi8b3: