Lineage for d1xi8b3 (1xi8 B:182-324)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 703405Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 703406Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) (S)
  5. 703471Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
  6. 703479Protein MoeA, central domain [64104] (4 species)
  7. 703513Species Pyrococcus furiosus [TaxId:2261] [117665] (1 PDB entry)
  8. 703515Domain d1xi8b3: 1xi8 B:182-324 [115354]
    Other proteins in same PDB: d1xi8a1, d1xi8a2, d1xi8b1, d1xi8b2
    Structural genomics target

Details for d1xi8b3

PDB Entry: 1xi8 (more details), 2.5 Å

PDB Description: molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu- 1657500-001
PDB Compounds: (B:) Molybdenum cofactor biosynthesis protein

SCOP Domain Sequences for d1xi8b3:

Sequence, based on SEQRES records: (download)

>d1xi8b3 c.57.1.2 (B:182-324) MoeA, central domain {Pyrococcus furiosus [TaxId: 2261]}
kpkvgiiitgselvqepsleefekgkivdtnsimlsalveryfgepilygvvpdnedlir
salekakrecdlvlitggsafgdmdyahkfvnllfhgttirpgrpigygervfvmsgypv
avftqfhlfvkhalaklvgakdy

Sequence, based on observed residues (ATOM records): (download)

>d1xi8b3 c.57.1.2 (B:182-324) MoeA, central domain {Pyrococcus furiosus [TaxId: 2261]}
kpkvgiiitgdtnsimlsalveryfgepilygvvpdnedlirsalekakrecdlvlitgv
nllfhgttirpgrpigygervfvmsgypvavftqfhlfvkhalaklvgakdy

SCOP Domain Coordinates for d1xi8b3:

Click to download the PDB-style file with coordinates for d1xi8b3.
(The format of our PDB-style files is described here.)

Timeline for d1xi8b3: