SCOP 1.73: Domain d1xi8b1: 1xi8 B:325-396

Lineage for d1xi8b1 (1xi8 B:325-396)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family)

5. Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)

7. Species Pyrococcus furiosus [TaxId:2261] [117333] (1 PDB entry)

8. Domain d1xi8b1: 1xi8 B:325-396 [115352]
   Other proteins in same PDB: d1xi8a2, d1xi8a3, d1xi8b2, d1xi8b3
   Structural genomics target

Details for d1xi8b1

PDB Entry: 1xi8, 2.5 Å

PDB Description: molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu- 1657500-001

PDB Compounds: (B:) Molybdenum cofactor biosynthesis protein

SCOP Domain Sequences for d1xi8b1:

Sequence, based on SEQRES records:

>d1xi8b1 b.85.6.1 (B:325-396) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
evkvravleddvpsqlgryefvrvmyrdgkakvikkkgsgiisslvqsnaylvvpedveg
yrrgeevwvtly

Sequence, based on observed residues (ATOM records):

>d1xi8b1 b.85.6.1 (B:325-396) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
evkvravleddvpsqlgryefvrvmyrdgkakvikkiisslvqsnaylvvpedvegyrrg
eevwvtly

Timeline for d1xi8b1:

• d1xi8b1 first appeared in SCOP 1.71
  
• d1xi8b1 appears in SCOP 1.75
  
• d1xi8b1 appears in the current release, SCOPe 2.08