Lineage for d1xi8b1 (1xi8 B:325-396)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568126Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 568335Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family) (S)
  5. 568336Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)
  6. 568341Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)
  7. 568351Species Pyrococcus furiosus [TaxId:186497] [117333] (1 PDB entry)
  8. 568353Domain d1xi8b1: 1xi8 B:325-396 [115352]
    Other proteins in same PDB: d1xi8a2, d1xi8a3, d1xi8b2, d1xi8b3
    Structural genomics target

Details for d1xi8b1

PDB Entry: 1xi8 (more details), 2.5 Å

PDB Description: molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu- 1657500-001

SCOP Domain Sequences for d1xi8b1:

Sequence, based on SEQRES records: (download)

>d1xi8b1 b.85.6.1 (B:325-396) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus furiosus}
evkvravleddvpsqlgryefvrvmyrdgkakvikkkgsgiisslvqsnaylvvpedveg
yrrgeevwvtly

Sequence, based on observed residues (ATOM records): (download)

>d1xi8b1 b.85.6.1 (B:325-396) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus furiosus}
evkvravleddvpsqlgryefvrvmyrdgkakvikkiisslvqsnaylvvpedvegyrrg
eevwvtly

SCOP Domain Coordinates for d1xi8b1:

Click to download the PDB-style file with coordinates for d1xi8b1.
(The format of our PDB-style files is described here.)

Timeline for d1xi8b1: