Lineage for d1xi8b1 (1xi8 B:325-396)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072411Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2072967Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) (S)
    automatically mapped to Pfam PF03454
  5. 2072968Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 protein domains)
  6. 2072976Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)
  7. 2073008Species Pyrococcus furiosus [TaxId:2261] [117333] (1 PDB entry)
    Uniprot Q8U034
  8. 2073010Domain d1xi8b1: 1xi8 B:325-396 [115352]
    Other proteins in same PDB: d1xi8a2, d1xi8a3, d1xi8b2, d1xi8b3
    Structural genomics target

Details for d1xi8b1

PDB Entry: 1xi8 (more details), 2.5 Å

PDB Description: molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu- 1657500-001
PDB Compounds: (B:) Molybdenum cofactor biosynthesis protein

SCOPe Domain Sequences for d1xi8b1:

Sequence, based on SEQRES records: (download)

>d1xi8b1 b.85.6.1 (B:325-396) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
evkvravleddvpsqlgryefvrvmyrdgkakvikkkgsgiisslvqsnaylvvpedveg
yrrgeevwvtly

Sequence, based on observed residues (ATOM records): (download)

>d1xi8b1 b.85.6.1 (B:325-396) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
evkvravleddvpsqlgryefvrvmyrdgkakvikkiisslvqsnaylvvpedvegyrrg
eevwvtly

SCOPe Domain Coordinates for d1xi8b1:

Click to download the PDB-style file with coordinates for d1xi8b1.
(The format of our PDB-style files is described here.)

Timeline for d1xi8b1: