Lineage for d1xi8a3 (1xi8 A:182-324)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 998094Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 998095Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 998176Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
  6. 998184Protein MoeA, central domain [64104] (4 species)
  7. 998216Species Pyrococcus furiosus [TaxId:2261] [117665] (1 PDB entry)
    Uniprot Q8U034
  8. 998217Domain d1xi8a3: 1xi8 A:182-324 [115351]
    Other proteins in same PDB: d1xi8a1, d1xi8a2, d1xi8b1, d1xi8b2
    Structural genomics target

Details for d1xi8a3

PDB Entry: 1xi8 (more details), 2.5 Å

PDB Description: molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu- 1657500-001
PDB Compounds: (A:) Molybdenum cofactor biosynthesis protein

SCOPe Domain Sequences for d1xi8a3:

Sequence, based on SEQRES records: (download)

>d1xi8a3 c.57.1.2 (A:182-324) MoeA, central domain {Pyrococcus furiosus [TaxId: 2261]}
kpkvgiiitgselvqepsleefekgkivdtnsimlsalveryfgepilygvvpdnedlir
salekakrecdlvlitggsafgdmdyahkfvnllfhgttirpgrpigygervfvmsgypv
avftqfhlfvkhalaklvgakdy

Sequence, based on observed residues (ATOM records): (download)

>d1xi8a3 c.57.1.2 (A:182-324) MoeA, central domain {Pyrococcus furiosus [TaxId: 2261]}
kpkvgiiitvdtnsimlsalveryfgepilygvvpdnedlirsalekakrecdlvlitgf
vnllfhgttirpgrpigygervfvmsgypvavftqfhlfvkhalaklvgakdy

SCOPe Domain Coordinates for d1xi8a3:

Click to download the PDB-style file with coordinates for d1xi8a3.
(The format of our PDB-style files is described here.)

Timeline for d1xi8a3: