SCOPe 2.08: Domain d1xi8a3: 1xi8 A:182-324

Lineage for d1xi8a3 (1xi8 A:182-324)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
   automatically mapped to Pfam PF00994

6. Protein MoeA, central domain [64104] (4 species)

7. Species Pyrococcus furiosus [TaxId:2261] [117665] (1 PDB entry)
   Uniprot Q8U034

8. Domain d1xi8a3: 1xi8 A:182-324 [115351]
   Other proteins in same PDB: d1xi8a1, d1xi8a2, d1xi8b1, d1xi8b2
   Structural genomics target
   missing some secondary structures that made up less than one-third of the common domain

Details for d1xi8a3

PDB Entry: 1xi8, 2.5 Å

PDB Description: molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu- 1657500-001

PDB Compounds: (A:) Molybdenum cofactor biosynthesis protein

SCOPe Domain Sequences for d1xi8a3:

Sequence, based on SEQRES records:

>d1xi8a3 c.57.1.2 (A:182-324) MoeA, central domain {Pyrococcus furiosus [TaxId: 2261]}
kpkvgiiitgselvqepsleefekgkivdtnsimlsalveryfgepilygvvpdnedlir
salekakrecdlvlitggsafgdmdyahkfvnllfhgttirpgrpigygervfvmsgypv
avftqfhlfvkhalaklvgakdy

Sequence, based on observed residues (ATOM records):

>d1xi8a3 c.57.1.2 (A:182-324) MoeA, central domain {Pyrococcus furiosus [TaxId: 2261]}
kpkvgiiitvdtnsimlsalveryfgepilygvvpdnedlirsalekakrecdlvlitgf
vnllfhgttirpgrpigygervfvmsgypvavftqfhlfvkhalaklvgakdy

Timeline for d1xi8a3:

• d1xi8a3 first appeared in SCOP 1.71
  
• d1xi8a3 appears in SCOPe 2.07