Lineage for d1xi8a2 (1xi8 A:6-181)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820794Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 2820795Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
    automatically mapped to Pfam PF03453
  5. 2820796Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)
  6. 2820804Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)
  7. 2820836Species Pyrococcus furiosus [TaxId:2261] [117341] (1 PDB entry)
    Uniprot Q8U034
  8. 2820837Domain d1xi8a2: 1xi8 A:6-181 [115350]
    Other proteins in same PDB: d1xi8a1, d1xi8a3, d1xi8b1, d1xi8b3
    Structural genomics target
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1xi8a2

PDB Entry: 1xi8 (more details), 2.5 Å

PDB Description: molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu- 1657500-001
PDB Compounds: (A:) Molybdenum cofactor biosynthesis protein

SCOPe Domain Sequences for d1xi8a2:

Sequence, based on SEQRES records: (download)

>d1xi8a2 b.103.1.1 (A:6-181) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Pyrococcus furiosus [TaxId: 2261]}
rltpyeealsivlndlkeieeveyvplkdalgrvlaedivasydlppfdraavdgyavra
edtfeareyspvelevieevpigenpnkeviagkaikvltggkiprganavimqemvkre
gskiyvlrpvapgqnisfagedvkkgdialkkgtilrpqdlallkalgirkvpvkv

Sequence, based on observed residues (ATOM records): (download)

>d1xi8a2 b.103.1.1 (A:6-181) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Pyrococcus furiosus [TaxId: 2261]}
rltpyeealsivlndlkeieeveyvplkdalgrvlaedivasydlsfagedvkkgdialk
kgtilrpqdlallkalgirkvpvkv

SCOPe Domain Coordinates for d1xi8a2:

Click to download the PDB-style file with coordinates for d1xi8a2.
(The format of our PDB-style files is described here.)

Timeline for d1xi8a2: