![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) ![]() automatically mapped to Pfam PF03454 |
![]() | Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins) |
![]() | Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [117333] (1 PDB entry) Uniprot Q8U034 |
![]() | Domain d1xi8a1: 1xi8 A:325-396 [115349] Other proteins in same PDB: d1xi8a2, d1xi8a3, d1xi8b2, d1xi8b3 Structural genomics target |
PDB Entry: 1xi8 (more details), 2.5 Å
SCOPe Domain Sequences for d1xi8a1:
Sequence, based on SEQRES records: (download)
>d1xi8a1 b.85.6.1 (A:325-396) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]} evkvravleddvpsqlgryefvrvmyrdgkakvikkkgsgiisslvqsnaylvvpedveg yrrgeevwvtly
>d1xi8a1 b.85.6.1 (A:325-396) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]} evkvravleddvpsqlgryefvrvmyrdgkakvikkgsgiisslvqsnaylvvpedvegy rrgeevwvtly
Timeline for d1xi8a1: