Lineage for d1xi4q_ (1xi4 Q:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2650135Fold i.23: clathrin assemblies [111484] (1 superfamily)
  4. 2650136Superfamily i.23.1: clathrin assemblies [111485] (1 family) (S)
  5. 2650137Family i.23.1.1: clathrin assemblies [111486] (2 proteins)
  6. 2650164Protein Clathrin D6 coat [118381] (1 species)
  7. 2650165Species Cow (Bos taurus) [TaxId:9913] [118382] (2 PDB entries)
  8. 2650182Domain d1xi4q_: 1xi4 Q: [115327]

Details for d1xi4q_

PDB Entry: 1xi4 (more details), 7.9 Å

PDB Description: clathrin d6 coat
PDB Compounds: (Q:) Clathrin light chain A

SCOPe Domain Sequences for d1xi4q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xi4q_ i.23.1.1 (Q:) Clathrin D6 coat {Cow (Bos taurus) [TaxId: 9913]}
vdrlqsepesirkwreeqterlealdansrkqeaewkekaikeldewyarqdeqlqktka
nnrvadeafy

SCOPe Domain Coordinates for d1xi4q_:

Click to download the PDB-style file with coordinates for d1xi4q_.
(The format of our PDB-style files is described here.)

Timeline for d1xi4q_: