![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.1: DNA polymerase I [56673] (5 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein phi29 DNA polymerase [118193] (1 species) |
![]() | Species Bacteriophage phi-29 [TaxId:10756] [118194] (8 PDB entries) Uniprot P03680 |
![]() | Domain d1xi1a2: 1xi1 A:188-575 [115310] Other proteins in same PDB: d1xi1a1, d1xi1b1 protein/DNA complex; complexed with mg |
PDB Entry: 1xi1 (more details), 2.2 Å
SCOPe Domain Sequences for d1xi1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xi1a2 e.8.1.1 (A:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]} mtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeigegmv fdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqikrs rfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfidkw tyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdpvyt pmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywahes tfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfenfk vgfsrkmkpkpvqvpggvvlvddtftik
Timeline for d1xi1a2: