SCOP 1.75: Domain d1xi1a1: 1xi1 A:5-187

Lineage for d1xi1a1 (1xi1 A:5-187)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (14 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species)

7. Species Bacteriophage phi-29 [TaxId:10756] [117651] (8 PDB entries)
   Uniprot P03680

8. Domain d1xi1a1: 1xi1 A:5-187 [115309]
   Other proteins in same PDB: d1xi1a2
   complexed with mg; mutant

Details for d1xi1a1

PDB Entry: 1xi1, 2.2 Å

PDB Description: phi29 dna polymerase ssdna complex, monoclinic crystal form

PDB Compounds: (A:) DNA polymerase

SCOP Domain Sequences for d1xi1a1:

Sequence; same for both SEQRES and ATOM records:

>d1xi1a1 c.55.3.5 (A:5-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
ldr

Timeline for d1xi1a1:

• d1xi1a1 first appeared in SCOP 1.71
  
• d1xi1a1 appears in SCOP 1.73
  
• d1xi1a1 appears in SCOPe 2.01
  
• d1xi1a1 appears in the current release, SCOPe 2.08