Lineage for d1xi1a1 (1xi1 A:5-187)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 702237Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
    contains Pfam PF00929
  6. 702279Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species)
  7. 702280Species Bacteriophage phi-29 [TaxId:10756] [117651] (4 PDB entries)
  8. 702282Domain d1xi1a1: 1xi1 A:5-187 [115309]
    Other proteins in same PDB: d1xi1a2
    complexed with mg; mutant

Details for d1xi1a1

PDB Entry: 1xi1 (more details), 2.2 Å

PDB Description: phi29 dna polymerase ssdna complex, monoclinic crystal form
PDB Compounds: (A:) DNA polymerase

SCOP Domain Sequences for d1xi1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xi1a1 c.55.3.5 (A:5-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
ldr

SCOP Domain Coordinates for d1xi1a1:

Click to download the PDB-style file with coordinates for d1xi1a1.
(The format of our PDB-style files is described here.)

Timeline for d1xi1a1: