Lineage for d1xhza2 (1xhz A:188-575)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 618192Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 618193Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 618194Family e.8.1.1: DNA polymerase I [56673] (4 proteins)
  6. 618289Protein phi29 DNA polymerase [118193] (1 species)
  7. 618290Species Bacteriophage phi-29 [TaxId:10756] [118194] (3 PDB entries)
  8. 618293Domain d1xhza2: 1xhz A:188-575 [115308]
    Other proteins in same PDB: d1xhza1
    mutant

Details for d1xhza2

PDB Entry: 1xhz (more details), 2.7 Å

PDB Description: phi29 dna polymerase, orthorhombic crystal form, ssdna complex

SCOP Domain Sequences for d1xhza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhza2 e.8.1.1 (A:188-575) phi29 DNA polymerase {Bacteriophage phi-29}
mtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeigegmv
fdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqikrs
rfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfidkw
tyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdpvyt
pmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywahes
tfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfenfk
vgfsrkmkpkpvqvpggvvlvddtftik

SCOP Domain Coordinates for d1xhza2:

Click to download the PDB-style file with coordinates for d1xhza2.
(The format of our PDB-style files is described here.)

Timeline for d1xhza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xhza1