![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins) contains Pfam PF00929 |
![]() | Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species) |
![]() | Species Bacteriophage phi-29 [TaxId:10756] [117651] (4 PDB entries) |
![]() | Domain d1xhza1: 1xhz A:5-187 [115307] Other proteins in same PDB: d1xhza2 mutant |
PDB Entry: 1xhz (more details), 2.7 Å
SCOP Domain Sequences for d1xhza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhza1 c.55.3.5 (A:5-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]} prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg ldr
Timeline for d1xhza1: