SCOP 1.71: Domain d1xhza1: 1xhz A:5-187

Lineage for d1xhza1 (1xhz A:5-187)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (10 proteins)
   contains Pfam 00929

6. Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species)

7. Species Bacteriophage phi-29 [TaxId:10756] [117651] (3 PDB entries)

8. Domain d1xhza1: 1xhz A:5-187 [115307]
   Other proteins in same PDB: d1xhza2
   mutant

Details for d1xhza1

PDB Entry: 1xhz, 2.7 Å

PDB Description: phi29 dna polymerase, orthorhombic crystal form, ssdna complex

SCOP Domain Sequences for d1xhza1:

Sequence; same for both SEQRES and ATOM records:

>d1xhza1 c.55.3.5 (A:5-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29}
prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
ldr

Timeline for d1xhza1:

• d1xhza1 is new in SCOP 1.71
  
• d1xhza1 appears in SCOP 1.73
  
• d1xhza1 appears in the current release, SCOPe 2.08