Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.269: Gamma-glutamyl cyclotransferase-like [110856] (1 superfamily) beta-alpha-beta(4)-alpha-beta(2); contains beta-sheet barrel (n=5, S=8) |
Superfamily d.269.1: Gamma-glutamyl cyclotransferase-like [110857] (1 family) |
Family d.269.1.1: Gamma-glutamyl cyclotransferase-like [110858] (4 proteins) Pfam PF03674 |
Protein Hypothetical protein YtfP [117853] (1 species) |
Species Escherichia coli [TaxId:562] [117854] (1 PDB entry) Uniprot P0AE48 |
Domain d1xhsa_: 1xhs A: [115304] Structural genomics target |
PDB Entry: 1xhs (more details)
SCOPe Domain Sequences for d1xhsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhsa_ d.269.1.1 (A:) Hypothetical protein YtfP {Escherichia coli [TaxId: 562]} mrifvygslrhkqgnshwmtnaqllgdfsidnyqlyslghypgavpgngtvhgevyridn atlaeldalrtrggeyarqliqtpygsawmyvyqrpvdglkliesgdwldrdk
Timeline for d1xhsa_: