Lineage for d1xhsa_ (1xhs A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 617077Fold d.269: BtrG-like [110856] (1 superfamily)
    beta-alpha-beta(4)-alpha-beta(2); contains beta-sheet barrel (n=5, S=8)
  4. 617078Superfamily d.269.1: BtrG-like [110857] (1 family) (S)
  5. 617079Family d.269.1.1: BtrG-like [110858] (3 proteins)
    Pfam 03674
  6. 617086Protein Hypothetical protein YtfP [117853] (1 species)
  7. 617087Species Escherichia coli [TaxId:562] [117854] (1 PDB entry)
  8. 617088Domain d1xhsa_: 1xhs A: [115304]
    Structural genomics target

Details for d1xhsa_

PDB Entry: 1xhs (more details)

PDB Description: solution nmr structure of protein ytfp from escherichia coli. northeast structural genomics consortium target er111.

SCOP Domain Sequences for d1xhsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhsa_ d.269.1.1 (A:) Hypothetical protein YtfP {Escherichia coli}
mrifvygslrhkqgnshwmtnaqllgdfsidnyqlyslghypgavpgngtvhgevyridn
atlaeldalrtrggeyarqliqtpygsawmyvyqrpvdglkliesgdwldrdk

SCOP Domain Coordinates for d1xhsa_:

Click to download the PDB-style file with coordinates for d1xhsa_.
(The format of our PDB-style files is described here.)

Timeline for d1xhsa_: