SCOPe 2.06: Domain d1xhoc1: 1xho C:3-113

Lineage for d1xhoc1 (1xho C:3-113)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (3 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.2: Chorismate mutase [55304] (1 protein)
   automatically mapped to Pfam PF07736

6. Protein Chorismate mutase [55305] (3 species)

7. Species Clostridium thermocellum [TaxId:1515] [118025] (1 PDB entry)
   Uniprot Q5KXU6 5-114 # 53% sequence identity

8. Domain d1xhoc1: 1xho C:3-113 [115303]
   Other proteins in same PDB: d1xhoa2, d1xhob2, d1xhoc2
   Structural genomics target; GI:67848919
   complexed with unx

Details for d1xhoc1

PDB Entry: 1xho, 2.2 Å

PDB Description: chorismate mutase from clostridium thermocellum cth-682

PDB Compounds: (C:) chorismate mutase

SCOPe Domain Sequences for d1xhoc1:

Sequence; same for both SEQRES and ATOM records:

>d1xhoc1 d.79.1.2 (C:3-113) Chorismate mutase {Clostridium thermocellum [TaxId: 1515]}
wairgattvsdntadeivaetqkllkemaekngleeddiisiiftvtkdldaafpaiaar
nmgwtstalmcmneidvpgslekcirvmmhvntdkdkkdikhvylngakvl

Timeline for d1xhoc1:

• d1xhoc1 first appeared in SCOP 1.71, called d1xhoc_
  
• d1xhoc1 was called d1xhoc_ in SCOPe 2.05
  
• d1xhoc1 appears in SCOPe 2.07
  
• d1xhoc1 appears in the current release, SCOPe 2.08