Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (2 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.2: Chorismate mutase [55304] (1 protein) |
Protein Chorismate mutase [55305] (3 species) |
Species Clostridium thermocellum [TaxId:1515] [118025] (1 PDB entry) |
Domain d1xhoc_: 1xho C: [115303] Structural genomics target; GI:67848919 |
PDB Entry: 1xho (more details), 2.2 Å
SCOP Domain Sequences for d1xhoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhoc_ d.79.1.2 (C:) Chorismate mutase {Clostridium thermocellum} mvwairgattvsdntadeivaetqkllkemaekngleeddiisiiftvtkdldaafpaia arnmgwtstalmcmneidvpgslekcirvmmhvntdkdkkdikhvylngakvl
Timeline for d1xhoc_: