SCOP 1.71: Domain d1xhoc_: 1xho C:

Lineage for d1xhoc_ (1xho C:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (2 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.2: Chorismate mutase [55304] (1 protein)

6. Protein Chorismate mutase [55305] (3 species)

7. Species Clostridium thermocellum [TaxId:1515] [118025] (1 PDB entry)

8. Domain d1xhoc_: 1xho C: [115303]
   Structural genomics target; GI:67848919

Details for d1xhoc_

PDB Entry: 1xho, 2.2 Å

PDB Description: chorismate mutase from clostridium thermocellum cth-682

SCOP Domain Sequences for d1xhoc_:

Sequence; same for both SEQRES and ATOM records:

>d1xhoc_ d.79.1.2 (C:) Chorismate mutase {Clostridium thermocellum}
mvwairgattvsdntadeivaetqkllkemaekngleeddiisiiftvtkdldaafpaia
arnmgwtstalmcmneidvpgslekcirvmmhvntdkdkkdikhvylngakvl

Timeline for d1xhoc_:

• d1xhoc_ is new in SCOP 1.71
  
• d1xhoc_ appears in SCOP 1.73
  
• d1xhoc_ appears in the current release, SCOPe 2.08, called d1xhoc1