Lineage for d1xhoc1 (1xho C:3-113)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525086Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2525212Family d.79.1.2: Chorismate mutase [55304] (1 protein)
    automatically mapped to Pfam PF07736
  6. 2525213Protein Chorismate mutase [55305] (3 species)
  7. 2525280Species Clostridium thermocellum [TaxId:1515] [118025] (1 PDB entry)
    Uniprot Q5KXU6 5-114 # 53% sequence identity
  8. 2525283Domain d1xhoc1: 1xho C:3-113 [115303]
    Other proteins in same PDB: d1xhoa2, d1xhob2, d1xhoc2
    Structural genomics target; GI:67848919
    complexed with unx

Details for d1xhoc1

PDB Entry: 1xho (more details), 2.2 Å

PDB Description: chorismate mutase from clostridium thermocellum cth-682
PDB Compounds: (C:) chorismate mutase

SCOPe Domain Sequences for d1xhoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhoc1 d.79.1.2 (C:3-113) Chorismate mutase {Clostridium thermocellum [TaxId: 1515]}
wairgattvsdntadeivaetqkllkemaekngleeddiisiiftvtkdldaafpaiaar
nmgwtstalmcmneidvpgslekcirvmmhvntdkdkkdikhvylngakvl

SCOPe Domain Coordinates for d1xhoc1:

Click to download the PDB-style file with coordinates for d1xhoc1.
(The format of our PDB-style files is described here.)

Timeline for d1xhoc1: