Lineage for d1xhoc1 (1xho C:3-113)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. Family d.79.1.2: Chorismate mutase [55304] (1 protein)
    automatically mapped to Pfam PF07736
  6. Protein Chorismate mutase [55305] (3 species)
  7. Species Clostridium thermocellum [TaxId:1515] [118025] (1 PDB entry)
    Uniprot Q5KXU6 5-114 # 53% sequence identity
  8. Domain d1xhoc1: 1xho C:3-113 [115303]
    Other proteins in same PDB: d1xhoa2, d1xhob2, d1xhoc2
    Structural genomics target; GI:67848919
    complexed with unx

Details for d1xhoc1

PDB Entry: 1xho (more details), 2.2 Å

PDB Description: chorismate mutase from clostridium thermocellum cth-682
PDB Compounds: (C:) chorismate mutase

SCOPe Domain Sequences for d1xhoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhoc1 d.79.1.2 (C:3-113) Chorismate mutase {Clostridium thermocellum [TaxId: 1515]}
wairgattvsdntadeivaetqkllkemaekngleeddiisiiftvtkdldaafpaiaar
nmgwtstalmcmneidvpgslekcirvmmhvntdkdkkdikhvylngakvl

SCOPe Domain Coordinates for d1xhoc1 are not available.

Timeline for d1xhoc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xhoc2
View in 3D
Domains from other chains:
(mouse over for more information)
d1xhoa1, d1xhoa2, d1xhob1, d1xhob2