SCOPe 2.03: Domain d1xhob_: 1xho B:

Lineage for d1xhob_ (1xho B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (3 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.2: Chorismate mutase [55304] (1 protein)
   automatically mapped to Pfam PF07736

6. Protein Chorismate mutase [55305] (3 species)

7. Species Clostridium thermocellum [TaxId:1515] [118025] (1 PDB entry)
   Uniprot Q5KXU6 5-114 # 53% sequence identity

8. Domain d1xhob_: 1xho B: [115302]
   Structural genomics target; GI:67848919
   complexed with unx

Details for d1xhob_

PDB Entry: 1xho, 2.2 Å

PDB Description: chorismate mutase from clostridium thermocellum cth-682

PDB Compounds: (B:) chorismate mutase

SCOPe Domain Sequences for d1xhob_:

Sequence; same for both SEQRES and ATOM records:

>d1xhob_ d.79.1.2 (B:) Chorismate mutase {Clostridium thermocellum [TaxId: 1515]}
vwairgattvsdntadeivaetqkllkemaekngleeddiisiiftvtkdldaafpaiaa
rnmgwtstalmcmneidvpgslekcirvmmhvntdkdkkdikhvylngakvl

Timeline for d1xhob_:

• d1xhob_ first appeared in SCOP 1.71
  
• d1xhob_ appears in SCOPe 2.02
  
• d1xhob_ appears in SCOPe 2.04
  
• d1xhob_ appears in the current release, SCOPe 2.08, called d1xhob1