Lineage for d1xhoa_ (1xho A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1420572Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 1420698Family d.79.1.2: Chorismate mutase [55304] (1 protein)
    automatically mapped to Pfam PF07736
  6. 1420699Protein Chorismate mutase [55305] (3 species)
  7. 1420742Species Clostridium thermocellum [TaxId:1515] [118025] (1 PDB entry)
    Uniprot Q5KXU6 5-114 # 53% sequence identity
  8. 1420743Domain d1xhoa_: 1xho A: [115301]
    Structural genomics target; GI:67848919
    complexed with unx

Details for d1xhoa_

PDB Entry: 1xho (more details), 2.2 Å

PDB Description: chorismate mutase from clostridium thermocellum cth-682
PDB Compounds: (A:) chorismate mutase

SCOPe Domain Sequences for d1xhoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhoa_ d.79.1.2 (A:) Chorismate mutase {Clostridium thermocellum [TaxId: 1515]}
vwairgattvsdntadeivaetqkllkemaekngleeddiisiiftvtkdldaafpaiaa
rnmgwtstalmcmneidvpgslekcirvmmhvntdkdkkdikhvylngakvl

SCOPe Domain Coordinates for d1xhoa_:

Click to download the PDB-style file with coordinates for d1xhoa_.
(The format of our PDB-style files is described here.)

Timeline for d1xhoa_: