| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (4 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
| Family d.79.1.2: Chorismate mutase [55304] (1 protein) automatically mapped to Pfam PF07736 |
| Protein Chorismate mutase [55305] (3 species) |
| Species Clostridium thermocellum [TaxId:1515] [118025] (1 PDB entry) Uniprot Q5KXU6 5-114 # 53% sequence identity |
| Domain d1xhoa1: 1xho A:3-113 [115301] Other proteins in same PDB: d1xhoa2, d1xhob2, d1xhoc2 Structural genomics target; GI:67848919 complexed with unx |
PDB Entry: 1xho (more details), 2.2 Å
SCOPe Domain Sequences for d1xhoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhoa1 d.79.1.2 (A:3-113) Chorismate mutase {Clostridium thermocellum [TaxId: 1515]}
wairgattvsdntadeivaetqkllkemaekngleeddiisiiftvtkdldaafpaiaar
nmgwtstalmcmneidvpgslekcirvmmhvntdkdkkdikhvylngakvl
Timeline for d1xhoa1:
View in 3DDomains from other chains: (mouse over for more information) d1xhob1, d1xhob2, d1xhoc1, d1xhoc2 |