SCOP 1.75: Domain d1xhkb_: 1xhk B:

Lineage for d1xhkb_ (1xhk B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.10: ATP-dependent protease Lon (La), catalytic domain [102769] (1 protein)
   contains extra C-terminal alpha/beta subdomain

6. Protein ATP-dependent protease Lon (La), catalytic domain [102770] (2 species)

7. Species Methanococcus jannaschii [TaxId:2190] [117794] (1 PDB entry)
   Uniprot Q58812 456-640 # MJ1417

8. Domain d1xhkb_: 1xhk B: [115300]
   complexed with mes, so4

Details for d1xhkb_

PDB Entry: 1xhk, 1.9 Å

PDB Description: Crystal structure of M. jannaschii Lon proteolytic domain

PDB Compounds: (B:) Putative protease La homolog

SCOP Domain Sequences for d1xhkb_:

Sequence; same for both SEQRES and ATOM records:

>d1xhkb_ d.14.1.10 (B:) ATP-dependent protease Lon (La), catalytic domain {Methanococcus jannaschii [TaxId: 2190]}
hmepkvgviyglavlgaggigdvtkiivqilesknpgthllnisgdiakhsitlasalsk
klvaekklplpkkdidlnnkeiyiqfsqsyskidgdsataavclaiisalldiplkqdfa
itgsldlsgnvlaiggvnekieaakrygfkrviipeanmidvietegieiipvktldeiv
plvfdld

Timeline for d1xhkb_:

• d1xhkb_ first appeared in SCOP 1.71
  
• d1xhkb_ appears in SCOP 1.73
  
• d1xhkb_ appears in SCOPe 2.01
  
• d1xhkb_ appears in the current release, SCOPe 2.08, called d1xhkb1