Lineage for d1xhkb_ (1xhk B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 717042Family d.14.1.10: ATP-dependent protease Lon (La), catalytic domain [102769] (1 protein)
    contains extra C-terminal alpha/beta subdomain
  6. 717043Protein ATP-dependent protease Lon (La), catalytic domain [102770] (2 species)
  7. 717057Species Methanococcus jannaschii [TaxId:2190] [117794] (1 PDB entry)
  8. 717059Domain d1xhkb_: 1xhk B: [115300]
    complexed with mes, so4

Details for d1xhkb_

PDB Entry: 1xhk (more details), 1.9 Å

PDB Description: Crystal structure of M. jannaschii Lon proteolytic domain
PDB Compounds: (B:) Putative protease La homolog

SCOP Domain Sequences for d1xhkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhkb_ d.14.1.10 (B:) ATP-dependent protease Lon (La), catalytic domain {Methanococcus jannaschii [TaxId: 2190]}
hmepkvgviyglavlgaggigdvtkiivqilesknpgthllnisgdiakhsitlasalsk
klvaekklplpkkdidlnnkeiyiqfsqsyskidgdsataavclaiisalldiplkqdfa
itgsldlsgnvlaiggvnekieaakrygfkrviipeanmidvietegieiipvktldeiv
plvfdld

SCOP Domain Coordinates for d1xhkb_:

Click to download the PDB-style file with coordinates for d1xhkb_.
(The format of our PDB-style files is described here.)

Timeline for d1xhkb_: