SCOPe 2.05: Domain d1xhka_: 1xhk A:

Lineage for d1xhka_ (1xhk A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.10: ATP-dependent protease Lon (La), catalytic domain [102769] (1 protein)
   contains extra C-terminal alpha/beta subdomain
   automatically mapped to Pfam PF05362

6. Protein ATP-dependent protease Lon (La), catalytic domain [102770] (2 species)

7. Species Methanococcus jannaschii [TaxId:2190] [117794] (1 PDB entry)
   Uniprot Q58812 456-640 # MJ1417

8. Domain d1xhka_: 1xhk A: [115299]
   complexed with mes, so4

Details for d1xhka_

PDB Entry: 1xhk, 1.9 Å

PDB Description: Crystal structure of M. jannaschii Lon proteolytic domain

PDB Compounds: (A:) Putative protease La homolog

SCOPe Domain Sequences for d1xhka_:

Sequence; same for both SEQRES and ATOM records:

>d1xhka_ d.14.1.10 (A:) ATP-dependent protease Lon (La), catalytic domain {Methanococcus jannaschii [TaxId: 2190]}
epkvgviyglavlgaggigdvtkiivqilesknpgthllnisgdiakhsitlasalskkl
vaekklplpkkdidlnnkeiyiqfsqsyskidgdsataavclaiisalldiplkqdfait
gsldlsgnvlaiggvnekieaakrygfkrviipeanmidvietegieiipvktldeivpl
vfdld

Timeline for d1xhka_:

• d1xhka_ first appeared in SCOP 1.71
  
• d1xhka_ appears in SCOPe 2.04
  
• d1xhka_ appears in SCOPe 2.06
  
• d1xhka_ appears in the current release, SCOPe 2.08