Lineage for d1xhga2 (1xhg A:240-307)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720612Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 720613Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 720743Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 720763Species Pig (Sus scrofa) [TaxId:9823] [117869] (2 PDB entries)
  8. 720765Domain d1xhga2: 1xhg A:240-307 [115297]
    Other proteins in same PDB: d1xhga1
    complexed with nag

Details for d1xhga2

PDB Entry: 1xhg (more details), 2.9 Å

PDB Description: crystal structure of a 40 kda signalling protein from porcine (spp-40) at 2.89a resolution
PDB Compounds: (A:) spp-40

SCOP Domain Sequences for d1xhga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhga2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Pig (Sus scrofa) [TaxId: 9823]}
fgksftlassktdvgapvsgpgipgqftkekgilayyeicdflqgatthrfrdqqvpyat
kgnqwvay

SCOP Domain Coordinates for d1xhga2:

Click to download the PDB-style file with coordinates for d1xhga2.
(The format of our PDB-style files is described here.)

Timeline for d1xhga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xhga1