Lineage for d1xhga1 (1xhg A:1-239,A:308-361)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816441Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 816611Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 816633Species Pig (Sus scrofa) [TaxId:9823] [117369] (4 PDB entries)
    Uniprot Q5UC99
  8. 816637Domain d1xhga1: 1xhg A:1-239,A:308-361 [115296]
    Other proteins in same PDB: d1xhga2
    complexed with nag

Details for d1xhga1

PDB Entry: 1xhg (more details), 2.9 Å

PDB Description: crystal structure of a 40 kda signalling protein from porcine (spp-40) at 2.89a resolution
PDB Compounds: (A:) spp-40

SCOP Domain Sequences for d1xhga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhga1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Pig (Sus scrofa) [TaxId: 9823]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpnlktllsvggwnfgpqrfskiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgqedassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlar

SCOP Domain Coordinates for d1xhga1:

Click to download the PDB-style file with coordinates for d1xhga1.
(The format of our PDB-style files is described here.)

Timeline for d1xhga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xhga2