![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
![]() | Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (4 proteins) archaeal hexapeptide repeat proteins this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain |
![]() | Protein Putative acetyltransferase/acyltransferase BC4754 [117308] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [117309] (1 PDB entry) Uniprot Q816R4 |
![]() | Domain d1xhda1: 1xhd A:1-169 [115295] Other proteins in same PDB: d1xhda2 Structural genomics target complexed with so4 |
PDB Entry: 1xhd (more details), 1.9 Å
SCOPe Domain Sequences for d1xhda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhda1 b.81.1.5 (A:1-169) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} miypykekkpkiassafiadyvtitgdvyvgeessiwfntvirgdvsptiigdrvnvqdq ctlhqspqyplileddvtvghqvilhschikkdaligmgsiildgaeigegafigagslv sqgkkippntlafgrpakvireltaedrkdmerirtqyvekgqyykslq
Timeline for d1xhda1: