SCOPe 2.08: Domain d1xhda1: 1xhd A:1-169

Lineage for d1xhda1 (1xhd A:1-169)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (4 proteins)
   archaeal hexapeptide repeat proteins
   this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain

6. Protein Putative acetyltransferase/acyltransferase BC4754 [117308] (1 species)

7. Species Bacillus cereus [TaxId:1396] [117309] (1 PDB entry)
   Uniprot Q816R4

8. Domain d1xhda1: 1xhd A:1-169 [115295]
   Other proteins in same PDB: d1xhda2
   Structural genomics target
   complexed with so4

Details for d1xhda1

PDB Entry: 1xhd, 1.9 Å

PDB Description: X-ray crystal structure of putative acetyltransferase, product of BC4754 gene [Bacillus cereus]

PDB Compounds: (A:) putative acetyltransferase/acyltransferase

SCOPe Domain Sequences for d1xhda1:

Sequence; same for both SEQRES and ATOM records:

>d1xhda1 b.81.1.5 (A:1-169) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]}
miypykekkpkiassafiadyvtitgdvyvgeessiwfntvirgdvsptiigdrvnvqdq
ctlhqspqyplileddvtvghqvilhschikkdaligmgsiildgaeigegafigagslv
sqgkkippntlafgrpakvireltaedrkdmerirtqyvekgqyykslq

Timeline for d1xhda1:

• d1xhda1 first appeared in SCOP 1.71, called d1xhda_
  
• d1xhda1 appears in SCOPe 2.07