SCOPe 2.05: Domain d1xhca3: 1xhc A:290-351

Lineage for d1xhca3 (1xhc A:290-351)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein NADH oxidase /nitrite reductase [118042] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [118043] (1 PDB entry)
   Uniprot Q8U1K9

8. Domain d1xhca3: 1xhc A:290-351 [115294]
   Other proteins in same PDB: d1xhca1, d1xhca2
   Structural genomics target
   complexed with fad

Details for d1xhca3

PDB Entry: 1xhc, 2.35 Å

PDB Description: nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001

PDB Compounds: (A:) NADH oxidase /nitrite reductase

SCOPe Domain Sequences for d1xhca3:

Sequence, based on SEQRES records:

>d1xhca3 d.87.1.1 (A:290-351) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}
prrynfkfrstvfkfgklqiaiigntkgegkwiedntkvfyengkiigavvfndirkatk
le

Sequence, based on observed residues (ATOM records):

>d1xhca3 d.87.1.1 (A:290-351) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}
prrynfkfrstvfkfgklqiaiigntkgegkwiedntkvfyigavvfndirkatkle

Timeline for d1xhca3:

• d1xhca3 first appeared in SCOP 1.71
  
• d1xhca3 appears in SCOPe 2.04
  
• d1xhca3 appears in SCOPe 2.06
  
• d1xhca3 appears in the current release, SCOPe 2.08