Lineage for d1xhca3 (1xhc A:289-351)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607191Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 607192Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 607193Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 607268Protein NADH oxidase /nitrite reductase [118042] (1 species)
  7. 607269Species Pyrococcus furiosus [TaxId:186497] [118043] (1 PDB entry)
  8. 607270Domain d1xhca3: 1xhc A:289-351 [115294]
    Other proteins in same PDB: d1xhca1, d1xhca2
    Structural genomics target
    complexed with fad

Details for d1xhca3

PDB Entry: 1xhc (more details), 2.35 Å

PDB Description: nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001

SCOP Domain Sequences for d1xhca3:

Sequence, based on SEQRES records: (download)

>d1xhca3 d.87.1.1 (A:289-351) NADH oxidase /nitrite reductase {Pyrococcus furiosus}
eprrynfkfrstvfkfgklqiaiigntkgegkwiedntkvfyengkiigavvfndirkat
kle

Sequence, based on observed residues (ATOM records): (download)

>d1xhca3 d.87.1.1 (A:289-351) NADH oxidase /nitrite reductase {Pyrococcus furiosus}
eprrynfkfrstvfkfgklqiaiigntkgegkwiedntkvfyigavvfndirkatkle

SCOP Domain Coordinates for d1xhca3:

Click to download the PDB-style file with coordinates for d1xhca3.
(The format of our PDB-style files is described here.)

Timeline for d1xhca3: