Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein NADH oxidase /nitrite reductase [117442] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [117443] (1 PDB entry) |
Domain d1xhca2: 1xhc A:104-225 [115293] Other proteins in same PDB: d1xhca3 Structural genomics target complexed with fad |
PDB Entry: 1xhc (more details), 2.35 Å
SCOP Domain Sequences for d1xhca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} rarepqikgkeylltlrtifdadrikesiensgeaiiigggfiglelagnlaeagyhvkl ihrgamflgldeelsnmikdmleetgvkfflnselleaneegvltnsgfiegkvkicaig iv
Timeline for d1xhca2: