Lineage for d1xhca1 (1xhc A:2-103,A:226-289)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2850071Protein NADH oxidase /nitrite reductase [117442] (1 species)
  7. 2850072Species Pyrococcus furiosus [TaxId:2261] [117443] (1 PDB entry)
    Uniprot Q8U1K9
  8. 2850073Domain d1xhca1: 1xhc A:2-103,A:226-289 [115292]
    Other proteins in same PDB: d1xhca3, d1xhca4
    Structural genomics target
    complexed with fad

Details for d1xhca1

PDB Entry: 1xhc (more details), 2.35 Å

PDB Description: nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001
PDB Compounds: (A:) NADH oxidase /nitrite reductase

SCOPe Domain Sequences for d1xhca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhca1 c.3.1.5 (A:2-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}
kvvivgngpggfelakqlsqtyevtvidkepvpyyskpmlshyiagfiprnrlfpysldw
yrkrgieirlaeeaklidrgrkvvitekgevpydtlvlatgaXpnvdlarrsgihtgrgi
liddnfrtsakdvyaigdcaeysgiiagtakaameqarvladilkge

SCOPe Domain Coordinates for d1xhca1:

Click to download the PDB-style file with coordinates for d1xhca1.
(The format of our PDB-style files is described here.)

Timeline for d1xhca1: