Lineage for d1xhba2 (1xhb A:95-422)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133865Family c.68.1.17: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain [117702] (1 protein)
  6. 2133866Protein Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain [117703] (1 species)
  7. 2133867Species Mouse (Mus musculus) [TaxId:10090] [117704] (1 PDB entry)
    Uniprot O08912
  8. 2133868Domain d1xhba2: 1xhb A:95-422 [115291]
    Other proteins in same PDB: d1xhba1
    complexed with ca, mn

Details for d1xhba2

PDB Entry: 1xhb (more details), 2.5 Å

PDB Description: the crystal structure of udp-galnac: polypeptide alpha-n- acetylgalactosaminyltransferase-t1
PDB Compounds: (A:) Polypeptide N-acetylgalactosaminyltransferase 1

SCOPe Domain Sequences for d1xhba2:

Sequence, based on SEQRES records: (download)

>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
nrslpdvrlegcktkvypdnlpttsvvivfhneawstllrtvhsvinrsprhmieeivlv
ddaserdflkrplesyvkklkvpvhvirmeqrsglirarlkgaavsrgqvitfldahcec
tagwlepllarikhdrrtvvcpiidvisddtfeymagsdmtyggfnwklnfrwypvpqre
mdrrkgdrtlpvrtptmagglfsidrdyfqeigtydagmdiwggenleisfriwqcggtl
eivtcshvghvfrkatpytfpggtgqiinknnrrlaevwmdefknffyiispgvtkvdyg
dissrlglrrklqckpfswyleniypds

Sequence, based on observed residues (ATOM records): (download)

>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
nrslpdvrlegcktkvypdnlpttsvvivfhneawstllrtvhsvinrsprhmieeivlv
ddaserdflkrplesyvkklkvpvhvirmeqrsglirarlkgaavsrgqvitfldahcec
tagwlepllarikhdrrtvvcpiidvisddtfeymagsdmtyggfnwklnfrwypvpqre
mdrrkgdrtlpvrtptmagglfsidrdyfqeigtydagmdiwggenleisfriwqcggtl
eivtcshvghvfgqiinknnrrlaevwmdefknffyiispgvtkvdygdissrlglrrkl
qckpfswyleniypds

SCOPe Domain Coordinates for d1xhba2:

Click to download the PDB-style file with coordinates for d1xhba2.
(The format of our PDB-style files is described here.)

Timeline for d1xhba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xhba1