Class b: All beta proteins [48724] (178 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain [117210] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117211] (1 PDB entry) Uniprot O08912 |
Domain d1xhba1: 1xhb A:423-553 [115290] Other proteins in same PDB: d1xhba2 complexed with bma, ca, mn, nag |
PDB Entry: 1xhb (more details), 2.5 Å
SCOPe Domain Sequences for d1xhba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} qiprhyfslgeirnvetnqcldnmarkenekvgifnchgmggnqvfsytankeirtddlc ldvsklngpvtmlkchhlkgnqlweydpvkltlqhvnsnqcldkateedsqvpsirdctg srsqqwllrnv
Timeline for d1xhba1: