SCOPe 2.06: Domain d1xhba1: 1xhb A:423-553

Lineage for d1xhba1 (1xhb A:423-553)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain [117210] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117211] (1 PDB entry)
   Uniprot O08912

8. Domain d1xhba1: 1xhb A:423-553 [115290]
   Other proteins in same PDB: d1xhba2
   complexed with ca, mn

Details for d1xhba1

PDB Entry: 1xhb, 2.5 Å

PDB Description: the crystal structure of udp-galnac: polypeptide alpha-n- acetylgalactosaminyltransferase-t1

PDB Compounds: (A:) Polypeptide N-acetylgalactosaminyltransferase 1

SCOPe Domain Sequences for d1xhba1:

Sequence; same for both SEQRES and ATOM records:

>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
qiprhyfslgeirnvetnqcldnmarkenekvgifnchgmggnqvfsytankeirtddlc
ldvsklngpvtmlkchhlkgnqlweydpvkltlqhvnsnqcldkateedsqvpsirdctg
srsqqwllrnv

Timeline for d1xhba1:

• d1xhba1 first appeared in SCOP 1.71
  
• d1xhba1 appears in SCOPe 2.05
  
• d1xhba1 appears in SCOPe 2.07
  
• d1xhba1 appears in the current release, SCOPe 2.08