Lineage for d1xhba1 (1xhb A:423-553)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792072Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2792073Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2792209Protein Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain [117210] (1 species)
  7. 2792210Species Mouse (Mus musculus) [TaxId:10090] [117211] (1 PDB entry)
    Uniprot O08912
  8. 2792211Domain d1xhba1: 1xhb A:423-553 [115290]
    Other proteins in same PDB: d1xhba2
    complexed with ca, mn

Details for d1xhba1

PDB Entry: 1xhb (more details), 2.5 Å

PDB Description: the crystal structure of udp-galnac: polypeptide alpha-n- acetylgalactosaminyltransferase-t1
PDB Compounds: (A:) Polypeptide N-acetylgalactosaminyltransferase 1

SCOPe Domain Sequences for d1xhba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
qiprhyfslgeirnvetnqcldnmarkenekvgifnchgmggnqvfsytankeirtddlc
ldvsklngpvtmlkchhlkgnqlweydpvkltlqhvnsnqcldkateedsqvpsirdctg
srsqqwllrnv

SCOPe Domain Coordinates for d1xhba1:

Click to download the PDB-style file with coordinates for d1xhba1.
(The format of our PDB-style files is described here.)

Timeline for d1xhba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xhba2