Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (12 PDB entries) Uniprot P30685 25-300 |
Domain d1xh3a2: 1xh3 A:1-181 [115288] Other proteins in same PDB: d1xh3a1, d1xh3b_ |
PDB Entry: 1xh3 (more details), 1.48 Å
SCOPe Domain Sequences for d1xh3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xh3a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]} gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq r
Timeline for d1xh3a2: