SCOPe 2.06: Domain d1xg8a1: 1xg8 A:2-102

Lineage for d1xg8a1 (1xg8 A:2-102)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.17: YuzD-like [117605] (1 protein)
   Pfam PF07315

6. Protein Hypothetical protein SA0798 [117606] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [117607] (1 PDB entry)
   Uniprot Q7A6J8

8. Domain d1xg8a1: 1xg8 A:2-102 [115283]
   Other proteins in same PDB: d1xg8a2
   Structural genomics target

Details for d1xg8a1

PDB Entry: 1xg8, 2.1 Å

PDB Description: Crystal Structure of Protein of Unknown Function SA0789 from Staphylococcus aureus

PDB Compounds: (A:) hypothetical protein SA0798

SCOPe Domain Sequences for d1xg8a1:

Sequence, based on SEQRES records:

>d1xg8a1 c.47.1.17 (A:2-102) Hypothetical protein SA0798 {Staphylococcus aureus [TaxId: 1280]}
vvygadvicascvnaptskdiydwlqpllkrkypnisfkytyiditkdndnltdhdlqfi
erieqdelfyplitmndeyvadgyiqtkqitrfidqklvne

Sequence, based on observed residues (ATOM records):

>d1xg8a1 c.47.1.17 (A:2-102) Hypothetical protein SA0798 {Staphylococcus aureus [TaxId: 1280]}
vvygadvicascvnaptskdiydwlqpllkrkypnisfkytyiditkdltdhdlqfieri
eqdelfyplitmndeyvadgyiqtkqitrfidqklvne

Timeline for d1xg8a1:

• d1xg8a1 first appeared in SCOP 1.71, called d1xg8a_
  
• d1xg8a1 was called d1xg8a_ in SCOPe 2.05
  
• d1xg8a1 appears in SCOPe 2.07
  
• d1xg8a1 appears in the current release, SCOPe 2.08