Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.17: YuzD-like [117605] (1 protein) Pfam PF07315 |
Protein Hypothetical protein SA0798 [117606] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [117607] (1 PDB entry) Uniprot Q7A6J8 |
Domain d1xg8a_: 1xg8 A: [115283] Structural genomics target |
PDB Entry: 1xg8 (more details), 2.1 Å
SCOPe Domain Sequences for d1xg8a_:
Sequence, based on SEQRES records: (download)
>d1xg8a_ c.47.1.17 (A:) Hypothetical protein SA0798 {Staphylococcus aureus [TaxId: 1280]} anlyfqsnavvvygadvicascvnaptskdiydwlqpllkrkypnisfkytyiditkdnd nltdhdlqfierieqdelfyplitmndeyvadgyiqtkqitrfidqklvne
>d1xg8a_ c.47.1.17 (A:) Hypothetical protein SA0798 {Staphylococcus aureus [TaxId: 1280]} anlyfqsnavvvygadvicascvnaptskdiydwlqpllkrkypnisfkytyiditkdlt dhdlqfierieqdelfyplitmndeyvadgyiqtkqitrfidqklvne
Timeline for d1xg8a_: