Lineage for d1xg8a_ (1xg8 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854333Family c.47.1.17: YuzD-like [117605] (1 protein)
    Pfam PF07315
  6. 1854334Protein Hypothetical protein SA0798 [117606] (1 species)
  7. 1854335Species Staphylococcus aureus [TaxId:1280] [117607] (1 PDB entry)
    Uniprot Q7A6J8
  8. 1854336Domain d1xg8a_: 1xg8 A: [115283]
    Structural genomics target

Details for d1xg8a_

PDB Entry: 1xg8 (more details), 2.1 Å

PDB Description: Crystal Structure of Protein of Unknown Function SA0789 from Staphylococcus aureus
PDB Compounds: (A:) hypothetical protein SA0798

SCOPe Domain Sequences for d1xg8a_:

Sequence, based on SEQRES records: (download)

>d1xg8a_ c.47.1.17 (A:) Hypothetical protein SA0798 {Staphylococcus aureus [TaxId: 1280]}
anlyfqsnavvvygadvicascvnaptskdiydwlqpllkrkypnisfkytyiditkdnd
nltdhdlqfierieqdelfyplitmndeyvadgyiqtkqitrfidqklvne

Sequence, based on observed residues (ATOM records): (download)

>d1xg8a_ c.47.1.17 (A:) Hypothetical protein SA0798 {Staphylococcus aureus [TaxId: 1280]}
anlyfqsnavvvygadvicascvnaptskdiydwlqpllkrkypnisfkytyiditkdlt
dhdlqfierieqdelfyplitmndeyvadgyiqtkqitrfidqklvne

SCOPe Domain Coordinates for d1xg8a_:

Click to download the PDB-style file with coordinates for d1xg8a_.
(The format of our PDB-style files is described here.)

Timeline for d1xg8a_: