Lineage for d1xg8a_ (1xg8 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 585454Family c.47.1.17: YuzD-like [117605] (1 protein)
    Pfam 07315
  6. 585455Protein Hypothetical protein SA0798 [117606] (1 species)
  7. 585456Species Staphylococcus aureus [TaxId:1280] [117607] (1 PDB entry)
  8. 585457Domain d1xg8a_: 1xg8 A: [115283]
    Structural genomics target

Details for d1xg8a_

PDB Entry: 1xg8 (more details), 2.1 Å

PDB Description: Crystal Structure of Protein of Unknown Function SA0789 from Staphylococcus aureus

SCOP Domain Sequences for d1xg8a_:

Sequence, based on SEQRES records: (download)

>d1xg8a_ c.47.1.17 (A:) Hypothetical protein SA0798 {Staphylococcus aureus}
anlyfqsnavvvygadvicascvnaptskdiydwlqpllkrkypnisfkytyiditkdnd
nltdhdlqfierieqdelfyplitmndeyvadgyiqtkqitrfidqklvne

Sequence, based on observed residues (ATOM records): (download)

>d1xg8a_ c.47.1.17 (A:) Hypothetical protein SA0798 {Staphylococcus aureus}
anlyfqsnavvvygadvicascvnaptskdiydwlqpllkrkypnisfkytyiditkdlt
dhdlqfierieqdelfyplitmndeyvadgyiqtkqitrfidqklvne

SCOP Domain Coordinates for d1xg8a_:

Click to download the PDB-style file with coordinates for d1xg8a_.
(The format of our PDB-style files is described here.)

Timeline for d1xg8a_: