Lineage for d1xg8a1 (1xg8 A:2-102)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878867Family c.47.1.17: YuzD-like [117605] (1 protein)
    Pfam PF07315
  6. 2878868Protein Hypothetical protein SA0798 [117606] (1 species)
  7. 2878869Species Staphylococcus aureus [TaxId:1280] [117607] (1 PDB entry)
    Uniprot Q7A6J8
  8. 2878870Domain d1xg8a1: 1xg8 A:2-102 [115283]
    Other proteins in same PDB: d1xg8a2
    Structural genomics target

Details for d1xg8a1

PDB Entry: 1xg8 (more details), 2.1 Å

PDB Description: Crystal Structure of Protein of Unknown Function SA0789 from Staphylococcus aureus
PDB Compounds: (A:) hypothetical protein SA0798

SCOPe Domain Sequences for d1xg8a1:

Sequence, based on SEQRES records: (download)

>d1xg8a1 c.47.1.17 (A:2-102) Hypothetical protein SA0798 {Staphylococcus aureus [TaxId: 1280]}
vvygadvicascvnaptskdiydwlqpllkrkypnisfkytyiditkdndnltdhdlqfi
erieqdelfyplitmndeyvadgyiqtkqitrfidqklvne

Sequence, based on observed residues (ATOM records): (download)

>d1xg8a1 c.47.1.17 (A:2-102) Hypothetical protein SA0798 {Staphylococcus aureus [TaxId: 1280]}
vvygadvicascvnaptskdiydwlqpllkrkypnisfkytyiditkdltdhdlqfieri
eqdelfyplitmndeyvadgyiqtkqitrfidqklvne

SCOPe Domain Coordinates for d1xg8a1:

Click to download the PDB-style file with coordinates for d1xg8a1.
(The format of our PDB-style files is described here.)

Timeline for d1xg8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xg8a2