SCOPe 2.07: Domain d1xg7b_: 1xg7 B:

Lineage for d1xg7b_ (1xg7 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.6: AgoG-like [116976] (2 proteins)
   automatically mapped to Pfam PF09171

6. Protein Hypothetical protein PF0904 [116979] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [116980] (2 PDB entries)
   Uniprot Q8U2D5

8. Domain d1xg7b_: 1xg7 B: [115282]
   Other proteins in same PDB: d1xg7a2
   Structural genomics target

Details for d1xg7b_

PDB Entry: 1xg7, 1.88 Å

PDB Description: conserved hypothetical protein pfu-877259-001 from pyrococcus furiosus

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d1xg7b_:

Sequence; same for both SEQRES and ATOM records:

>d1xg7b_ a.96.1.6 (B:) Hypothetical protein PF0904 {Pyrococcus furiosus [TaxId: 2261]}
elveiikgigiegakeveekvdrqfyalqylfrhqdpemfiklvianslvsyqltgrged
wwwefaryfsgrevdsiwkaygeflpksknnrrlieaklnrirkvegflstltlkdlegy
yknmkmlwkalikimgsredsktivftvkmfgyasriafsrfipypmeipipedlriksv
tskltqekptkfwmkigqesgvpplhidsliwpllgnadltpldielrnklmkltellg

Timeline for d1xg7b_:

• d1xg7b_ first appeared in SCOP 1.71
  
• d1xg7b_ appears in SCOPe 2.06
  
• d1xg7b_ appears in the current release, SCOPe 2.08