Lineage for d1xg7b_ (1xg7 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2721121Family a.96.1.6: AgoG-like [116976] (2 proteins)
    automatically mapped to Pfam PF09171
  6. 2721126Protein Hypothetical protein PF0904 [116979] (1 species)
  7. 2721127Species Pyrococcus furiosus [TaxId:2261] [116980] (2 PDB entries)
    Uniprot Q8U2D5
  8. 2721129Domain d1xg7b_: 1xg7 B: [115282]
    Other proteins in same PDB: d1xg7a2
    Structural genomics target

Details for d1xg7b_

PDB Entry: 1xg7 (more details), 1.88 Å

PDB Description: conserved hypothetical protein pfu-877259-001 from pyrococcus furiosus
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d1xg7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xg7b_ a.96.1.6 (B:) Hypothetical protein PF0904 {Pyrococcus furiosus [TaxId: 2261]}
elveiikgigiegakeveekvdrqfyalqylfrhqdpemfiklvianslvsyqltgrged
wwwefaryfsgrevdsiwkaygeflpksknnrrlieaklnrirkvegflstltlkdlegy
yknmkmlwkalikimgsredsktivftvkmfgyasriafsrfipypmeipipedlriksv
tskltqekptkfwmkigqesgvpplhidsliwpllgnadltpldielrnklmkltellg

SCOPe Domain Coordinates for d1xg7b_:

Click to download the PDB-style file with coordinates for d1xg7b_.
(The format of our PDB-style files is described here.)

Timeline for d1xg7b_: