Lineage for d1xg7a1 (1xg7 A:2-242)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. Family a.96.1.6: AgoG-like [116976] (2 proteins)
    automatically mapped to Pfam PF09171
  6. Protein Hypothetical protein PF0904 [116979] (1 species)
  7. Species Pyrococcus furiosus [TaxId:2261] [116980] (2 PDB entries)
    Uniprot Q8U2D5
  8. Domain d1xg7a1: 1xg7 A:2-242 [115281]
    Other proteins in same PDB: d1xg7a2
    Structural genomics target

Details for d1xg7a1

PDB Entry: 1xg7 (more details), 1.8800000000000001 Å

PDB Description: conserved hypothetical protein pfu-877259-001 from pyrococcus furiosus
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1xg7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xg7a1 a.96.1.6 (A:2-242) Hypothetical protein PF0904 {Pyrococcus furiosus [TaxId: 2261]}
relveiikgigiegakeveekvdrqfyalqylfrhqdpemfiklvianslvsyqltgrge
dwwwefaryfsgrevdsiwkaygeflpksknnrrlieaklnrirkvegflstltlkdleg
yyknmkmlwkalikimgsredsktivftvkmfgyasriafsrfipypmeipipedlriks
vtskltqekptkfwmkigqesgvpplhidsliwpllgnadltpldielrnklmkltellg
l

SCOPe Domain Coordinates for d1xg7a1 are not available.

Timeline for d1xg7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xg7a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1xg7b_