Lineage for d1xg7a1 (1xg7 A:2-242)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003278Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2003279Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2003409Family a.96.1.6: AgoG-like [116976] (2 protein domains)
    automatically mapped to Pfam PF09171
  6. 2003414Protein Hypothetical protein PF0904 [116979] (1 species)
  7. 2003415Species Pyrococcus furiosus [TaxId:2261] [116980] (2 PDB entries)
    Uniprot Q8U2D5
  8. 2003416Domain d1xg7a1: 1xg7 A:2-242 [115281]
    Other proteins in same PDB: d1xg7a2
    Structural genomics target

Details for d1xg7a1

PDB Entry: 1xg7 (more details), 1.88 Å

PDB Description: Conserved hypothetical protein Pfu-877259-001 from Pyrococcus furiosus
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1xg7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xg7a1 a.96.1.6 (A:2-242) Hypothetical protein PF0904 {Pyrococcus furiosus [TaxId: 2261]}
relveiikgigiegakeveekvdrqfyalqylfrhqdpemfiklvianslvsyqltgrge
dwwwefaryfsgrevdsiwkaygeflpksknnrrlieaklnrirkvegflstltlkdleg
yyknmkmlwkalikimgsredsktivftvkmfgyasriafsrfipypmeipipedlriks
vtskltqekptkfwmkigqesgvpplhidsliwpllgnadltpldielrnklmkltellg
l

SCOPe Domain Coordinates for d1xg7a1:

Click to download the PDB-style file with coordinates for d1xg7a1.
(The format of our PDB-style files is described here.)

Timeline for d1xg7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xg7a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1xg7b_