Lineage for d1xg5d_ (1xg5 D:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820572Protein Putative dehydrogenase ARPG836 (MGC4172) [117411] (1 species)
  7. 820573Species Human (Homo sapiens) [TaxId:9606] [117412] (1 PDB entry)
    Uniprot Q6UWP2
  8. 820577Domain d1xg5d_: 1xg5 D: [115280]
    complexed with acy, nap

Details for d1xg5d_

PDB Entry: 1xg5 (more details), 1.53 Å

PDB Description: Structure of human putative dehydrogenase MGC4172 in complex with NADP
PDB Compounds: (D:) arpg836

SCOP Domain Sequences for d1xg5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xg5d_ c.2.1.2 (D:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]}
arpgmerwrdrlalvtgasggigaavaralvqqglkvvgcartvgnieelaaecksagyp
gtlipyrcdlsneedilsmfsairsqhsgvdicinnaglarpdtllsgstsgwkdmfnvn
vlalsictreayqsmkernvddghiininsmsghrvlplsvthfysatkyavtalteglr
qelreaqthiratcispgvvetqfafklhdkdpekaaatyeqmkclkpedvaeaviyvls
tpahiqigdiqmrptgs

SCOP Domain Coordinates for d1xg5d_:

Click to download the PDB-style file with coordinates for d1xg5d_.
(The format of our PDB-style files is described here.)

Timeline for d1xg5d_: