SCOP 1.71: Domain d1xg5d_: 1xg5 D:

Lineage for d1xg5d_ (1xg5 D:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (53 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Putative dehydrogenase ARPG836 (MGC4172) [117411] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117412] (1 PDB entry)

8. Domain d1xg5d_: 1xg5 D: [115280]
   complexed with acy, nap

Details for d1xg5d_

PDB Entry: 1xg5, 1.53 Å

PDB Description: Structure of human putative dehydrogenase MGC4172 in complex with NADP

SCOP Domain Sequences for d1xg5d_:

Sequence; same for both SEQRES and ATOM records:

>d1xg5d_ c.2.1.2 (D:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens)}
arpgmerwrdrlalvtgasggigaavaralvqqglkvvgcartvgnieelaaecksagyp
gtlipyrcdlsneedilsmfsairsqhsgvdicinnaglarpdtllsgstsgwkdmfnvn
vlalsictreayqsmkernvddghiininsmsghrvlplsvthfysatkyavtalteglr
qelreaqthiratcispgvvetqfafklhdkdpekaaatyeqmkclkpedvaeaviyvls
tpahiqigdiqmrptgs

Timeline for d1xg5d_:

• d1xg5d_ is new in SCOP 1.71
  
• d1xg5d_ appears in SCOP 1.73
  
• d1xg5d_ appears in the current release, SCOPe 2.08, called d1xg5d1