SCOP 1.71: Domain d1xg0c_: 1xg0 C:

Lineage for d1xg0c_ (1xg0 C:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycoerythrin beta subunit [88513] (4 species)

7. Species Cryptophite (Rhodomonas sp.), cs24 [46544] (3 PDB entries)

8. Domain d1xg0c_: 1xg0 C: [115275]
   Other proteins in same PDB: d1xg0a_, d1xg0b_

Details for d1xg0c_

PDB Entry: 1xg0, 0.97 Å

PDB Description: High resolution crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas CS24

SCOP Domain Sequences for d1xg0c_:

Sequence, based on SEQRES records:

>d1xg0c_ a.1.1.3 (C:) Phycoerythrin beta subunit {Cryptophite (Rhodomonas sp.), cs24}
dafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmice
npslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgv
pansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais

Sequence, based on observed residues (ATOM records):

>d1xg0c_ a.1.1.3 (C:) Phycoerythrin beta subunit {Cryptophite (Rhodomonas sp.), cs24}
dafsrvvtadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmicen
pslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgvp
ansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais

Timeline for d1xg0c_:

• d1xg0c_ is new in SCOP 1.71
  
• d1xg0c_ appears in SCOP 1.73
  
• d1xg0c_ appears in the current release, SCOPe 2.08