Lineage for d1xg0a_ (1xg0 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237679Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 2237680Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) (S)
    not a true superfamily
  5. 2237681Family d.184.1.1: Phycoerythrin 545 alpha-subunits [56569] (1 protein)
    consists of a long beta-hairpin and a single alpha-helix
  6. 2237682Protein Phycoerythrin 545 alpha-subunits [56570] (1 species)
  7. 2237683Species Cryptophyte (Rhodomonas sp. CS24) [TaxId:79257] [56571] (3 PDB entries)
    Uniprot P30943 38-104 ! Uniprot Q00433 53-128
  8. 2237684Domain d1xg0a_: 1xg0 A: [115273]
    Other proteins in same PDB: d1xg0c_, d1xg0d_
    complexed with cl, dbv, mg, peb

Details for d1xg0a_

PDB Entry: 1xg0 (more details), 0.97 Å

PDB Description: High resolution crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas CS24
PDB Compounds: (A:) Phycoerythrin alpha-3 chain

SCOPe Domain Sequences for d1xg0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xg0a_ d.184.1.1 (A:) Phycoerythrin 545 alpha-subunits {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]}
amdksakapqitifdhrgcsrapkestggkaggqddemmvkvastkvtvsesdaakklqe
fitfekgidgpftskn

SCOPe Domain Coordinates for d1xg0a_:

Click to download the PDB-style file with coordinates for d1xg0a_.
(The format of our PDB-style files is described here.)

Timeline for d1xg0a_: